B3GNT8 antibody orb316549 from Biorbyt

Product Specs
ItemB3GNT8 antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb316549
Quantity10 µg, 100 µg
ApplicationsIHC, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman
TargetB3GNT8
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids
NCBI Full Gene NameUDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8
NCBI Gene AliasesB3GALT7, BGALT15, beta3Gn-T8
ClonalityPolyclonal
Molecular Weight43396 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat Western blot, 0.1-0.5µg/ml, Human

Add to Compare List